PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN16059.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 290aa    MW: 32874.1 Da    PI: 4.855
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN16059.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.46.5e-102332662255
                 SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
    Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                  +yp++ee+ +L++ +gL+++q+ +WF N+R ++
  KHN16059.1 233 WPYPTEEEKVQLSEMTGLDQKQINNWFINQRKRH 266
                 59*****************************885 PP

2ELK36.79.3e-13186207122
         ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                 ELK++LlrKY+gyL+sLk+EF+
  KHN16059.1 186 ELKEMLLRKYGGYLSSLKKEFL 207
                 9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-194387IPR005540KNOX1
PfamPF037904.7E-204585IPR005540KNOX1
SMARTSM012562.2E-2590141IPR005541KNOX2
PfamPF037918.9E-2493140IPR005541KNOX2
PfamPF037899.6E-10186207IPR005539ELK domain
SMARTSM011888.8E-7186207IPR005539ELK domain
PROSITE profilePS5121311.174186206IPR005539ELK domain
PROSITE profilePS5007112.746206269IPR001356Homeobox domain
SMARTSM003897.3E-14208273IPR001356Homeobox domain
SuperFamilySSF466892.61E-20208282IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27211271IPR009057Homeodomain-like
CDDcd000863.05E-13218270No hitNo description
PfamPF059202.3E-17226265IPR008422Homeobox KN domain
PROSITE patternPS000270244267IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 290 aa     Download sequence    Send to blast
MNPLLSCSGG DVVREVNVNS ATGASELNLG LVANNFFSDI SDRFIKSQIA THPLYPNLVS  60
AYIECRKVGA PPELASLLEE IARESYPTDA LREIGDDPEL DEFMESYCEV LHRYKQELSK  120
PFNEATLFLC SIESQLSNLC KGTLTMPLDN NHSDEAAGTS EDELSWEKVE AVEGHESSGP  180
RPGDQELKEM LLRKYGGYLS SLKKEFLKKR KKGKLPKDAR MVLMDWWNTH YRWPYPTEEE  240
KVQLSEMTGL DQKQINNWFI NQRKRHWKPS EDMRFAIMDG VSGSGFGGPI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1201210LKKEFLKKRK
2207211KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0940970.0BT094097.1 Soybean clone JCVI-FLGm-18M11 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003536044.10.0PREDICTED: homeobox protein knotted-1-like 10 isoform X1
SwissprotQ9FP295e-98KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLA0A0B2Q7V60.0A0A0B2Q7V6_GLYSO; Homeobox protein knotted-1-like 1
TrEMBLK7LJG70.0K7LJG7_SOYBN; Uncharacterized protein
STRINGGLYMA10G28820.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62034125
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23380.16e-84KNOTTED1-like homeobox gene 6
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]